PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK08316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 457aa    MW: 50768.3 Da    PI: 7.9086
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK08316.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-175599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a k++G g W+ I +++g ++t+ q++s+ qky
        PK08316.1 55 REKWTEEEHQKFLEALKLYGRG-WRQIEEHVG-TKTAVQIRSHAQKY 99
                     789*******************.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1649102IPR009057Homeodomain-like
PROSITE profilePS5129422.29750104IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-1052102IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-1753102IPR006447Myb domain, plants
SMARTSM007171.0E-1354102IPR001005SANT/Myb domain
PfamPF002491.6E-155599IPR001005SANT/Myb domain
CDDcd001671.15E-1157100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MVVEKQSEGM LSNNSVVAGN CITNGDAKYK SESPLKDLYE SAPKVRKPYT ITKQREKWTE  60
EEHQKFLEAL KLYGRGWRQI EEHVGTKTAV QIRSHAQKYF SKVVRGSSGS VEGCMKPVEI  120
PPPRPKRKPM HPYPRKFVES FNGTSVLNQL ERSPSPNFAA TDKGIKSPTS VLSSHGSDAV  180
GYDASDHQHK RSPSSTSCTT DMQSISLSPS DKENCYLMSN SSAEEKIPGN HLSSQSNVEN  240
VLSVKIEPGC KDTAHNNKED KLSTSTSFKL FGRTVLLSDL EKESHCSTDD SEALKTDEGQ  300
KLDTNLSLGG FGFASNCSPL ESSSPSNQTE QQKESSNIVK LNGDAQMLWW SMPQFPFHYQ  360
AAYNPSTGPT STEMEEKEIK KERSCTDSNE GSSSGVETVG NRNIEAFNSF SQEPHRKASV  420
EHCNSRKGFV PYKRCLAERD NHSTATSDRE RRKVRVC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099677.11e-172Myb-like protein G
TrEMBLW9RAU01e-172W9RAU0_9R
STRINGPOPTR_0012s03530.13e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.13e-49MYB_related family protein